Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0L9TDC9

dbSWEET id: dbswt_258

Accession:   A0A0L9TDC9

Uniprot status:   Unreviewed

Organism:   Phaseolus angularis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.

Sequence Information back to top


Sequence length:   263

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|A0A0L9TDC9|A0A0L9TDC9_PHAAN|Unreviewed|Phaseolus_angularis|263
MVAFSAQEMAFIFGLLGNIVSFLVFLAPLPTFYTIFKNKSSAGFQSIPYVVALLSALLLL
YYGFIKSNAILIVTINSIGCFIEVSYLTMYIVYAPKKQKISTLVMILIADIGGFGLTMLV
TIFAMKGINRVRAVGWVCAIFNIAVFAAPLSIMRKVIKTKSVEYMPFSLSLFLTLCATMW
FFYGLFDKDQFIMLPNVLGFLFGITQMILYMIYKNSEKKNTKANRAQQQESEGTVNTKQH
TCDDNKLDFPSVVEMKENQLDQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: A0A0L9TDC9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0L9TDC9_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    6.3% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0L9TDC9_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.2% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0L9TDC9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    6.3% allowed    .0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur