| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0L9TCC2
dbSWEET id: dbswt_132
Accession: A0A0L9TCC2
Uniprot status: Unreviewed
Organism: Phaseolus angularis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.
Sequence Information back to top
Sequence length: 270
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0L9TCC2|A0A0L9TCC2_PHAAN|Unreviewed|Phaseolus_angularis|270
MAILNSQNHMALAFGVLGNVISFMVYLAPLPTFYRIHKRKSTEGFQSLPYLVALFSSMLW
LYYATLKPAGATLLISINSVGSVIETVYIVMFLLYATHDARKLTVKLFMVMNVGSFALIF
IVTYFTMHGAHRVAVVGWVCVSIAVAVFAAPLSIVAQVIRTKNVEFMPFNLSVFLTLSAI
TWFSYGFFLKDICIAVPNVLGFALGLLQMLLYAIYRNSKPKNVAKEEPMKNIVVVNPLGT
SEVYPVQVIDKEKECPREDEKGVEAKERPA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: A0A0L9TCC2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0L9TCC2_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 3.6% allowed .0% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0L9TCC2_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 4.1% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0L9TCC2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 2.6% allowed 1.0% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA