| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0L8G9N5
dbSWEET id: dbswt_1051
Accession: A0A0L8G9N5
Uniprot status: Unreviewed
Organism: Octopus bimaculoides
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Mollusca ⇒ Cephalopoda ⇒ Coleoidea ⇒ Neocoleoidea ⇒ Octopodiformes ⇒ Octopoda ⇒ Incirrata ⇒ Octopodidae ⇒ Octopus.
Sequence Information back to top
Sequence length: 216
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSSV CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0L8G9N5|A0A0L8G9N5_OCTBM|Unreviewed|Octopus_bimaculoides|216
MAVEDIISWVTTVCTIGVSLIGFEICAKIARKGSPGDISFIPFLIMFISACLWLKYGLLR
RVFTVVFVNSVAALLQGMYMCIYYTYSLQRGHLNRLLFFGIVFLLLPLSYIRFYLPDESS
AIDFLGRLCCIISIFSYGSPLASVFHVVRTKSTECMSFPLATANFVVALEWFFYGALLKD
FYMQMPNMCGVLLCLFQFALFFKYPAKPQPILSIKA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: A0A0L8G9N5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0L8G9N5_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.0% favored 8.7% allowed 2.2% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0L8G9N5_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 7.1% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0L8G9N5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.0% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 106878269 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA