Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0L8G9N5

dbSWEET id: dbswt_1051

Accession:   A0A0L8G9N5

Uniprot status:   Unreviewed

Organism:   Octopus bimaculoides

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Mollusca ⇒ Cephalopoda ⇒ Coleoidea ⇒ Neocoleoidea ⇒ Octopodiformes ⇒ Octopoda ⇒ Incirrata ⇒ Octopodidae ⇒ Octopus.

Sequence Information back to top


Sequence length:   216

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSSV           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A0L8G9N5|A0A0L8G9N5_OCTBM|Unreviewed|Octopus_bimaculoides|216
MAVEDIISWVTTVCTIGVSLIGFEICAKIARKGSPGDISFIPFLIMFISACLWLKYGLLR
RVFTVVFVNSVAALLQGMYMCIYYTYSLQRGHLNRLLFFGIVFLLLPLSYIRFYLPDESS
AIDFLGRLCCIISIFSYGSPLASVFHVVRTKSTECMSFPLATANFVVALEWFFYGALLKD
FYMQMPNMCGVLLCLFQFALFFKYPAKPQPILSIKA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: A0A0L8G9N5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0L8G9N5_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.0% favored    8.7% allowed    2.2% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0L8G9N5_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.1% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0L8G9N5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.0% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   106878269     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur