| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0L0LN66
dbSWEET id: dbswt_1414
Accession: A0A0L0LN66
Uniprot status: Unreviewed
Organism: Parcubacteria bacterium
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 112
Substrate Binding Site: NINI CVV: 440 CHI: 2
Selectivity Filter: AVAV CVV: 344 CHI: 12
Fasta sequence:
>tr|A0A0L0LN66|A0A0L0LN66_9BACT|Unreviewed|Parcubacteria bacterium| 112
MSSGGMHHLHVRKRVYKNVDVFPSPDSFKRFLDKAMYVVGLISPIAFLPQVLDVYASHNV
SSLSLITWTVLALVNVLWTLYGWVHKEYAIFIANAFMAVLQIFLIGAIVIYR
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 34 Model end: 106 Inward Open: Template: 4X5M.pdb Model structure: A0A0L0LN66_inward.pdb Alignment file: A0A0L0LN66_inw.pir Procheck score ⇒ Ramachandran plot: 91.7% favored 6.8% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0L0LN66_outward.pdb Alignment file: A0A0L0LN66_out.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed .8% week 1.5% disallowed Occluded: Model structure: A0A0L0LN66_occluded.pdb Alignment file: A0A0L0LN66_occ.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 6.1% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA