| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0L0CLZ0
dbSWEET id: dbswt_1048
Accession: A0A0L0CLZ0
Uniprot status: Unreviewed
Organism: Lucilia cuprina
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Oestroidea ⇒ Calliphoridae ⇒ Luciliinae ⇒ Lucilia.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|A0A0L0CLZ0|A0A0L0CLZ0_LUCCU|Unreviewed|Lucilia_cuprina|226
MHNVEGFIALLETTAVVTTVLQYLSGAIICRKYIKKKSTGDSSGFPFICGFLSCSYWVHY
GMLSEERSVVLVNTIGVTLFLIYTLIYYVFTVNKNVYVKQFLFVLTALFGIVFYINGISD
VGQAQNFMGIVCCIVTVCFFAAPLTNLLHVIRVKNSESLPFPLIVMSFLVSIQWLIYGII
ISDTFIQLPNFLGCVLSLMQLCLFVCYPPKSFAGQGYKLVDQTVVF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: A0A0L0CLZ0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0L0CLZ0_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 2.1% allowed 2.7% week 2.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0L0CLZ0_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.4% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0L0CLZ0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 8.5% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA