Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K9RH44

dbSWEET id: dbswt_871

Accession:   A0A0K9RH44

Uniprot status:   Unreviewed

Organism:   Spinacia oleracea

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ Caryophyllales ⇒ Chenopodiaceae ⇒ Chenopodioideae ⇒ Anserineae ⇒ Spinacia.

Sequence Information back to top


Sequence length:   278

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VHLN           CVV:   443       CHI:   1.3

Fasta sequence:

>tr|A0A0K9RH44|A0A0K9RH44_SPIOL|Unreviewed|Spinacia_oleracea|278
MVVTSDTLIWLGQVKCSGNCGYISRKIQVADKQVNDSEPTTLAIAFDTMVNSENMLIVLG
VIGNVTSFFVFASLLPTIWRIWKNKSVDEFKYHPLAVGIIHSIMWVFYSMPFVHPHSIPV
TTVNSVGLVMYIIFNIIYYVNTNKTTRRSMVLHYIAEFVFLAGLVWSTLVTFDSHATRSG
YVGFFCVFFGIILYGLDLGITVKAIRAKNVKSRLLLYSLVCFLNGLVWSAYALVKYDPYI
LIENSLGALIGCIQFLLYIGYYCVERFRTIKLSPVDDC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   49     Model end:   263

Alignment file: A0A0K9RH44.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K9RH44_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.7% allowed    1.0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K9RH44_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.7% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K9RH44_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.2% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur