Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K9RAB3

dbSWEET id: dbswt_268

Accession:   A0A0K9RAB3

Uniprot status:   Unreviewed

Organism:   Spinacia oleracea

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ Caryophyllales ⇒ Chenopodiaceae ⇒ Chenopodioideae ⇒ Anserineae ⇒ Spinacia.

Sequence Information back to top


Sequence length:   316

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|A0A0K9RAB3|A0A0K9RAB3_SPIOL|Unreviewed|Spinacia_oleracea|316
MAFTVIHLHQLTIIFGILGNIVSFGVFLAPLPTFWRIFKKKSTLGFQSIPYSVALFSSML
LLYYAFLKETNGTMILTINTIGCAIEGAYLIVYLIYATKESRVYTAKLLGLFNVGFFGVI
VLTTMLFVRGTDKHSMFSKGGMRVDVVGWICGIFSVCVFAAPLSVMRMVIKTKSVEFMPF
GLSVSLTLCAIIWFFYGFLIKDFYIALPNILGFAFGIVQMILYVIYNHLSKKRQNSNKIG
DDLMIKKADIIQLQELAININLGKIEPQNKPAEVIEIILEEMVDVNNNDNEDSNNIVNEV
DKKAANGEVPRGDNAC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   228

Alignment file: A0A0K9RAB3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K9RAB3_inward.pdb

Procheck score ⇒ Ramachandran plot: 83.7% favored    7.7% allowed    5.1% week    3.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K9RAB3_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.1% allowed    2.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K9RAB3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    6.1% allowed    3.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur