Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K9R879

dbSWEET id: dbswt_270

Accession:   A0A0K9R879

Uniprot status:   Unreviewed

Organism:   Spinacia oleracea

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ Caryophyllales ⇒ Chenopodiaceae ⇒ Chenopodioideae ⇒ Anserineae ⇒ Spinacia.

Sequence Information back to top


Sequence length:   321

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|A0A0K9R879|A0A0K9R879_SPIOL|Unreviewed|Spinacia_oleracea|321
MAFTSIHLHELSIIFGILGNIVSFGVFLAPLPTFWRIFKKKSTLGFQSIPYSVALFSCML
LLYYAFLKESNGTMIITINSIGCAIEAAYLTVYLIYATKKARVYTAKLLGLFNVGFLGLI
VVTTLVFVRGMDDHTMLSKGGMRESVVGWICGIFSVCVFAAPLSAMRMVIRTKSVEFMPF
WLSFSLTLCAIMWFFYGFLIRDFYIALPNVLGFAFGIAQMILYIIYKDSTKKQKNNNNNG
GDLMIKESDIMQLQELAVDIKLGKVEKIEQDSEQQNRPADAIEVIVEEMVDVNNNEGNND
IVKEVNGKSANRDVPRGDDAC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   228

Alignment file: A0A0K9R879.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K9R879_inward.pdb

Procheck score ⇒ Ramachandran plot: 85.4% favored    10.1% allowed    3.0% week    1.5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K9R879_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.1% allowed    1.0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K9R879_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    8.1% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur