| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0K9PHD3
dbSWEET id: dbswt_330
Accession: A0A0K9PHD3
Uniprot status: Unreviewed
Organism: Zostera marina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zosteraceae ⇒ Zostera.
Sequence Information back to top
Sequence length: 249
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0K9PHD3|A0A0K9PHD3_ZOSMR|Unreviewed|Zostera_marina|249
MAIGVGNPWAFTAGVFGNVISFMVFFAPVPIFLRICRRKSTESFDSLPYVVPLLSAMIWL
YFAFLTSDVLLMSINSAGIIVEGTYVLIFLYYADKHARALTLKLVMCLNVGVFGSLLVLT
LILAKGNTRINIIGWAGSTFAVSVFMSPLSVIRLVIKTKSVEFMPFTLSVFLTLSATAWF
AYGILRNDFYVAIPNVVGFIFGMVQMIVFVIYKDEKKVISSEENNNNIAKVGITSQSINM
QDYVINSIV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 214
Alignment file: A0A0K9PHD3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0K9PHD3_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed .0% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0K9PHD3_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.9% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0K9PHD3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 8.6% allowed .0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22