| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0K9P6Z0
dbSWEET id: dbswt_524
Accession: A0A0K9P6Z0
Uniprot status: Unreviewed
Organism: Zostera marina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zosteraceae ⇒ Zostera.
Sequence Information back to top
Sequence length: 250
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|A0A0K9P6Z0|A0A0K9P6Z0_ZOSMR|Unreviewed|Zostera_marina|250
MGEANLRLAIGIMGNASSLLLFASPILTFKKVLQKKNIEGFSCIPYIMAMFNCLLYTWYG
LPVVSRGWENFPLITINGLGIFLELSFVSIYLRFASIKQKASEKVNGCLLVPALLLFVGV
ALTSTFSFHNHRTRKILVGSFGLVASVLMYSSPLVAVKQVIKTRSVKFMPFHLSLFTFIA
TSLWMAYGLVTHDLVLAAPNMVGCPMGLLQLLVYFIYRNKTPEFEQPPLKVVDLEKNGSD
ITPAAPIIPA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 219
Alignment file: A0A0K9P6Z0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0K9P6Z0_inward.pdb
Procheck score ⇒ Ramachandran plot: 84.9% favored 8.3% allowed 4.7% week 2.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0K9P6Z0_outward.pdb
Procheck score ⇒ Ramachandran plot: 88.0% favored 9.4% allowed 2.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0K9P6Z0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 6.8% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA