Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K9P5L8

dbSWEET id: dbswt_818

Accession:   A0A0K9P5L8

Uniprot status:   Unreviewed

Organism:   Zostera marina

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zosteraceae ⇒ Zostera.

Sequence Information back to top


Sequence length:   236

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MNPN           CVV:   406       CHI:   -6.7

Fasta sequence:

>tr|A0A0K9P5L8|A0A0K9P5L8_ZOSMR|Unreviewed|Zostera_marina|236
MVSPDTIRTVVGTIGNMVSLIGMFLSPLPTFWRIWKKKSVEEFSPLPYLSMLMNCSLWIC
YGIPIVHPNSTLVLTVNGTGFIIEFMYVAGFFMYSGGKSRRGVLLILLSEFTYIAIMLSL
VLSLTHSLPRRSLIIGLHCVIGGTLPYISSLSIMKMVIKTKSVDFMSLPLSCAGFANGIC
WTLYALLRFDPFILIPNGIGLFLATMQLILYGIYYKSTQKQIEGRNNRSENNIQMT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   216

Alignment file: A0A0K9P5L8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K9P5L8_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.6% favored    3.3% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K9P5L8_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.9% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K9P5L8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    3.8% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur