| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0K9NQI0
dbSWEET id: dbswt_680
Accession: A0A0K9NQI0
Uniprot status: Unreviewed
Organism: Zostera marina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zosteraceae ⇒ Zostera.
Sequence Information back to top
Sequence length: 232
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A0K9NQI0|A0A0K9NQI0_ZOSMR|Unreviewed|Zostera_marina|232
MEKSDIHQFLSLACGVAGNLFAIVLFVSPIPTFRRILRNKSTEDFSGLPYIYSLLNCLLC
LWYGLPWVSRDLILIATVNSIGAIFQLVYVTIFIVNATQSRRMRVIGLLVSVFVLLGAIV
YISLIFFDFDSRHLFIGYLTVASLISMFASPLFIINLVIRTKSVEFMPFYLSLSTLLMSL
AFFAYGMLKFDFFVYTPNGIGVILGVIQLLLYAYYSRTTLEDGRTSLLHLHA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: A0A0K9NQI0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0K9NQI0_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 5.7% allowed 1.0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0K9NQI0_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 4.7% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0K9NQI0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.2% allowed .5% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA