Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K8UCU4

dbSWEET id: dbswt_1047

Accession:   A0A0K8UCU4

Uniprot status:   Unreviewed

Organism:   Bactrocera latifrons

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Tephritoidea ⇒ Tephritidae ⇒ Bactrocera ⇒ Bactrocera.

Sequence Information back to top


Sequence length:   253

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|A0A0K8UCU4|A0A0K8UCU4_BACLA|Unreviewed|Bactrocera_latifrons|253
MEALSNILAPYSHALANIAGTITTLQFLSGVIFLNDIRKRGRSDGYPPEPFLGGVVLSIL
TIKMGTLMGDSATINVNLLGLALSAVFLGVFYWYASNELKGEILSKIGIAAAFTVVCLAY
ATIENPKKIEFRFGMLITGILVFLVGSPLLQLNKIIEKKSTEGMPFPIIFTGTLVAASWA
LYGISIHNFMMAYQNLFLFALSAIQLSLFVIYPSSPSVSEPSVKHSPSTLEHKTSQGKTS
SPSKTSVGSKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: A0A0K8UCU4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K8UCU4_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.8% favored    4.4% allowed    2.2% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K8UCU4_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.8% favored    6.1% allowed    .6% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K8UCU4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.6% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur