| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0K8TS03
dbSWEET id: dbswt_1046
Accession: A0A0K8TS03
Uniprot status: Unreviewed
Organism: Tabanus bromius
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Tabanomorpha ⇒ Tabanoidea ⇒ Tabanidae ⇒ Tabanus.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|A0A0K8TS03|A0A0K8TS03_TABBR|Unreviewed|Tabanus_bromius|221
SYESILEISAVITTVLQYLSGVLVCQKYVQKKSTGDTSGLPFICGFLSSSLWLQYGLLTN
ERIIVIVNIIGAFLMLLYTITYYIFTVSKKSYVRQFAAAFIILMSAIIYAKYEEDQVKTI
AVMGILCCCITVLFFAAPFTMLVHVIRVKNTDSLPLPLILASFLVSLQWFIYGIIIDDTF
IQIPNFLGCVLSGAQLSLFICYPPKSYSGPSYKVIDQEVIY
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 204
Alignment file: A0A0K8TS03.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0K8TS03_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 6.5% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0K8TS03_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 6.5% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0K8TS03_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 6.5% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA