Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K8TRD9

dbSWEET id: dbswt_1045

Accession:   A0A0K8TRD9

Uniprot status:   Unreviewed

Organism:   Tabanus bromius

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Tabanomorpha ⇒ Tabanoidea ⇒ Tabanidae ⇒ Tabanus.

Sequence Information back to top


Sequence length:   218

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|A0A0K8TRD9|A0A0K8TRD9_TABBR|Unreviewed|Tabanus_bromius|218
LSVYKEELAAFAVIVTTLQFLSGFVVMNDVRKAGSSEKISLIPFLGGLVLTVASLKYGFM
INDAATIKVNIIGFMLNVIYVCFFYLYTPNEKKTEVWGKIGLAGLASAACVLYGDYEDPN
LVRTRYGTLITVMLISLVASPFLALGHVIRTKSTEALPFPIIASGTAVSLAWTLYGLSIG
NSVLIVQNLILLGIAAAQLSLFVIYPSKSPHDGLKKKQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: A0A0K8TRD9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K8TRD9_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    7.1% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K8TRD9_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.6% favored    9.3% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K8TRD9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    8.2% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur