Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0K8MUH1
dbSWEET id: dbswt_1413
Accession: A0A0K8MUH1
Uniprot status: Unreviewed
Organism: Fructobacillus tropaeoli
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Fructobacillus.
Sequence Information back to top
Sequence length: 123
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0K8MUH1|A0A0K8MUH1_9LACT|Unreviewed|Fructobacillus tropaeoli| 123
MYAENGYNLRYEQWRKEIFMRIDTSEYPTGENAVPEKRVKQLKLLSKAATFTCIAMYVSY
IPQIISNFSGHPVGVLQPLVAMINASFWAGYGWTKTYKDWPIIISNVPGILFGLFTVITI
YIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 46 Model end: 122
Inward Open:
Template: 4X5M.pdb
Model structure: A0A0K8MUH1_inward.pdb Alignment file: A0A0K8MUH1_inw.pir
Procheck score ⇒ Ramachandran plot: 88.1% favored 7.1% allowed 4.0% week .8% disallowed
Outward Open:
Template: 4X5N.pdb
Model structure: A0A0K8MUH1_outward.pdb Alignment file: A0A0K8MUH1_out.pir
Procheck score ⇒ Ramachandran plot: 88.9% favored 9.5% allowed 1.6% week .0% disallowed
Occluded:
Model structure: A0A0K8MUH1_occluded.pdb Alignment file: A0A0K8MUH1_occ.pir
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA