Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0K8MUF0
dbSWEET id: dbswt_1988
Accession: A0A0K8MUF0
Uniprot status: Unreviewed
Organism: Fructobacillus tropaeoli
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Fructobacillus.
Sequence Information back to top
Sequence length: 106
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0K8MUF0|A0A0K8MUF0_9LACT|Unreviewed|Fructobacillus tropaeoli| 106
MGMRVDNYVSPEEKKQVDEKRIKMLKIFSKVATVMNILMYVSYFPQIVSNFSGNPVNWLQ
PAVAMVNATLWTGYGWLKTYKDWPIIISNVPGIFFGAITFITVFIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 29 Model end: 105 Inward Open: Template: 4X5M.pdb Model structure: A0A0K8MUF0_inward.pdb Alignment file: A0A0K8MUF0_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.5% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0K8MUF0_outward.pdb Alignment file: A0A0K8MUF0_out.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 10.2% allowed .8% week .8% disallowed Occluded: Model structure: A0A0K8MUF0_occluded.pdb Alignment file: A0A0K8MUF0_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA