Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K8MPL9

dbSWEET id: dbswt_1986

Accession:   A0A0K8MPL9

Uniprot status:   Unreviewed

Organism:   Fructobacillus pseudoficulneus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Fructobacillus.

Sequence Information back to top


Sequence length:   106

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0K8MPL9|A0A0K8MPL9_9LACT|Unreviewed|Fructobacillus pseudoficulneus| 106
MGMRVDNYVSPEEKKEVDARRIKMLKIFSKVATVMNILMYVSYFPQIISNFSGNPVNPLQ
PAVAMINASLWTGYGWLKTYKDWPIIISNIPGIFFGMLTFVTVFIH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   29     Model end:   105

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0K8MPL9_inward.pdb    Alignment file: A0A0K8MPL9_inw.pir

Procheck score ⇒ Ramachandran plot: 88.1% favored    11.1% allowed    .0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0K8MPL9_outward.pdb    Alignment file: A0A0K8MPL9_out.pir

Procheck score ⇒ Ramachandran plot: 83.3% favored    10.3% allowed    5.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0K8MPL9_occluded.pdb    Alignment file: A0A0K8MPL9_occ.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.1% allowed    2.4% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur