| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0K8MPL9
dbSWEET id: dbswt_1986
Accession: A0A0K8MPL9
Uniprot status: Unreviewed
Organism: Fructobacillus pseudoficulneus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Fructobacillus.
Sequence Information back to top
Sequence length: 106
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0K8MPL9|A0A0K8MPL9_9LACT|Unreviewed|Fructobacillus pseudoficulneus| 106
MGMRVDNYVSPEEKKEVDARRIKMLKIFSKVATVMNILMYVSYFPQIISNFSGNPVNPLQ
PAVAMINASLWTGYGWLKTYKDWPIIISNIPGIFFGMLTFVTVFIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 29 Model end: 105 Inward Open: Template: 4X5M.pdb Model structure: A0A0K8MPL9_inward.pdb Alignment file: A0A0K8MPL9_inw.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 11.1% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0K8MPL9_outward.pdb Alignment file: A0A0K8MPL9_out.pir Procheck score ⇒ Ramachandran plot: 83.3% favored 10.3% allowed 5.6% week .8% disallowed Occluded: Model structure: A0A0K8MPL9_occluded.pdb Alignment file: A0A0K8MPL9_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.1% allowed 2.4% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA