Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0K8MIE5
dbSWEET id: dbswt_1985
Accession: A0A0K8MIE5
Uniprot status: Unreviewed
Organism: Fructobacillus ficulneus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Fructobacillus.
Sequence Information back to top
Sequence length: 106
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0K8MIE5|A0A0K8MIE5_9LACT|Unreviewed|Fructobacillus ficulneus| 106
MGMRVDNYVSPEERKRVDERRIKMLKIFSKVATVTCILMYVSYVPQIIANFSGNPVNPLQ
PAVAMINATLWTCYGWLKTYKDIPIIVSNVPGIVFGLVTLVTVYVH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 29 Model end: 105 Inward Open: Template: 4X5M.pdb Model structure: A0A0K8MIE5_inward.pdb Alignment file: A0A0K8MIE5_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 8.6% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0K8MIE5_outward.pdb Alignment file: A0A0K8MIE5_out.pir Procheck score ⇒ Ramachandran plot: 89.1% favored 10.2% allowed .8% week .0% disallowed Occluded: Model structure: A0A0K8MIE5_occluded.pdb Alignment file: A0A0K8MIE5_occ.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 4.7% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA