Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K8MED3

dbSWEET id: dbswt_1412

Accession:   A0A0K8MED3

Uniprot status:   Unreviewed

Organism:   Caedibacter varicaedens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Caedibacter.

Sequence Information back to top


Sequence length:   126

Substrate Binding Site:   LGLG           CVV:   344       CHI:   6.8

Selectivity Filter:   LSLS           CVV:   394       CHI:   6

Fasta sequence:

>tr|A0A0K8MED3|A0A0K8MED3_9RICK|Unreviewed|Caedibacter varicaedens| 126
MQQDHLKESVSSRSGEIFSEEKQGAHSFFATKEDTLSRTKTLYYYAKFMIVIGIFGHSLY
YLQAFKIYRQASAENVSLEGFLIALFSLTCWLIYGVLMKDKVLIIVNIFGVIGATLTTLA
IFSVYL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   46     Model end:   126

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0K8MED3_inward.pdb    Alignment file: A0A0K8MED3_inw.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    9.0% allowed    1.4% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0K8MED3_outward.pdb    Alignment file: A0A0K8MED3_out.pir

Procheck score ⇒ Ramachandran plot: 89.6% favored    8.3% allowed    1.4% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0K8MED3_occluded.pdb    Alignment file: A0A0K8MED3_occ.pir

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.2% allowed    .7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur