Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K2RZP1

dbSWEET id: dbswt_1411

Accession:   A0A0K2RZP1

Uniprot status:   Unreviewed

Organism:   Rothia mucilaginosa

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Micrococcales ⇒ Micrococcaceae ⇒ Rothia.

Sequence Information back to top


Sequence length:   113

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|A0A0K2RZP1|A0A0K2RZP1_9MICC|Unreviewed|Rothia mucilaginosa| 113
MAEQNNTSANTSAQNVSPKGGVGVDSEFHAKFFPILARVASVTAVLMYVFYFPQIIGNLN
GHKGDWIQPLVAAVNCTLWVLYGLWRPKKDVPIIIANLPGIVFGGVAAITALI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   37     Model end:   113

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0K2RZP1_inward.pdb    Alignment file: A0A0K2RZP1_inw.pir

Procheck score ⇒ Ramachandran plot: 85.5% favored    14.5% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0K2RZP1_outward.pdb    Alignment file: A0A0K2RZP1_out.pir

Procheck score ⇒ Ramachandran plot: 90.3% favored    8.9% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0K2RZP1_occluded.pdb    Alignment file: A0A0K2RZP1_occ.pir

Procheck score ⇒ Ramachandran plot: 95.2% favored    4.8% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur