Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0K2JAY1
dbSWEET id: dbswt_1409
Accession: A0A0K2JAY1
Uniprot status: Unreviewed
Organism: Leptotrichia
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0K2JAY1|A0A0K2JAY1_9FUSO|Unreviewed|Leptotrichia|85
MNERNLKILGWIGTILSVIMYVSYVPQIIGNLNGNKTFFLQPLAATINCTIWTSYGLLKE
KKDYPLAAANLPGIIFGLLATITAF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A0K2JAY1_inward.pdb Alignment file: A0A0K2JAY1_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0K2JAY1_outward.pdb Alignment file: A0A0K2JAY1_out.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 9.4% allowed .0% week .8% disallowed Occluded: Model structure: A0A0K2JAY1_occluded.pdb Alignment file: A0A0K2JAY1_occ.pir Procheck score ⇒ Ramachandran plot: 85.2% favored 11.7% allowed .8% week 2.3% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA