Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0K1P6U2
dbSWEET id: dbswt_1408
Accession: A0A0K1P6U2
Uniprot status: Unreviewed
Organism: Spiroplasma turonicum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Tenericutes ⇒ Mollicutes ⇒ Entomoplasmatales ⇒ Spiroplasmataceae ⇒ Spiroplasma.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: ASAS CVV: 280 CHI: 2
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|A0A0K1P6U2|A0A0K1P6U2_9MOLU|Unreviewed|Spiroplasma turonicum|92
MNLAIEIIGWMGFTTSLLMLLPQVFKVIKTRDTKSLSLFMFILTFLNALIWFSFGLLTKS
MQLYIANACAMTASIIIIVYIIINLIKSKKPQ
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 90 Inward Open: Template: 4X5M.pdb Model structure: A0A0K1P6U2_inward.pdb Alignment file: A0A0K1P6U2_inw.pir Procheck score ⇒ Ramachandran plot: 87.2% favored 7.7% allowed 3.8% week 1.3% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0K1P6U2_outward.pdb Alignment file: A0A0K1P6U2_out.pir Procheck score ⇒ Ramachandran plot: 84.6% favored 9.6% allowed 3.2% week 2.6% disallowed Occluded: Model structure: A0A0K1P6U2_occluded.pdb Alignment file: A0A0K1P6U2_occ.pir Procheck score ⇒ Ramachandran plot: 91.7% favored 6.4% allowed 1.3% week .6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA