Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K1P6U2

dbSWEET id: dbswt_1408

Accession:   A0A0K1P6U2

Uniprot status:   Unreviewed

Organism:   Spiroplasma turonicum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Tenericutes ⇒ Mollicutes ⇒ Entomoplasmatales ⇒ Spiroplasmataceae ⇒ Spiroplasma.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   ASAS           CVV:   280       CHI:   2

Selectivity Filter:   MNMN           CVV:   440       CHI:   -3.2

Fasta sequence:

>tr|A0A0K1P6U2|A0A0K1P6U2_9MOLU|Unreviewed|Spiroplasma turonicum|92
MNLAIEIIGWMGFTTSLLMLLPQVFKVIKTRDTKSLSLFMFILTFLNALIWFSFGLLTKS
MQLYIANACAMTASIIIIVYIIINLIKSKKPQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   90

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0K1P6U2_inward.pdb    Alignment file: A0A0K1P6U2_inw.pir

Procheck score ⇒ Ramachandran plot: 87.2% favored    7.7% allowed    3.8% week    1.3% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0K1P6U2_outward.pdb    Alignment file: A0A0K1P6U2_out.pir

Procheck score ⇒ Ramachandran plot: 84.6% favored    9.6% allowed    3.2% week    2.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0K1P6U2_occluded.pdb    Alignment file: A0A0K1P6U2_occ.pir

Procheck score ⇒ Ramachandran plot: 91.7% favored    6.4% allowed    1.3% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur