Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K1NF27

dbSWEET id: dbswt_1407

Accession:   A0A0K1NF27

Uniprot status:   Unreviewed

Organism:   Ottowia

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Burkholderiales ⇒ Comamonadaceae ⇒ Ottowia.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|A0A0K1NF27|A0A0K1NF27_9BURK|Unreviewed|Ottowia|85
MTEKQIKILGTIASIMSVGMYVAYIPQIADNLSGHKGNPVQPFVAFVNCSLWTCYGLFKK
QRDWPIVVANVPGIFLGLAAFFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0K1NF27_inward.pdb    Alignment file: A0A0K1NF27_inw.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    7.1% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0K1NF27_outward.pdb    Alignment file: A0A0K1NF27_out.pir

Procheck score ⇒ Ramachandran plot: 87.3% favored    7.1% allowed    2.4% week    3.2% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0K1NF27_occluded.pdb    Alignment file: A0A0K1NF27_occ.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    4.8% allowed    2.4% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur