Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K0JGE0

dbSWEET id: dbswt_1043

Accession:   A0A0K0JGE0

Uniprot status:   Unreviewed

Organism:   Brugia malayi

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Spirurida ⇒ Filarioidea ⇒ Onchocercidae ⇒ Brugia.

Sequence Information back to top


Sequence length:   243

Substrate Binding Site:   SQIN           CVV:   407       CHI:   -3.3

Selectivity Filter:   FGGL           CVV:   355       CHI:   5.8

Fasta sequence:

>tr|A0A0K0JGE0|A0A0K0JGE0_BRUMA|Unreviewed|Brugia_malayi|243
MSIADTLELMKIEFEKEIYNYFTNNLLWNLFLTSTGIVYILFISIPLQAVYKWYRQKSSD
SDSPIPYFATYVGSALWLRYSMYTANSKAVLLQAFSVFMQIFFIIAMLFYRTRKNKLLQL
LCLITIVLATIFVWAQMLRVEDGRAFIGSVASCSQTIGSSAYLFLIYQAVKRKVMDFIPF
GSVVLAWVLEIHIVIYSIGVRDFHLLIANGAFMVLNGLLLLMFFIYPTKAPKTKPSNLSS
TPT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   21     Model end:   228

Alignment file: A0A0K0JGE0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K0JGE0_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.0% favored    10.4% allowed    1.6% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K0JGE0_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.8% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K0JGE0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    6.8% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur