Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K0ESE3

dbSWEET id: dbswt_1041

Accession:   A0A0K0ESE3

Uniprot status:   Unreviewed

Organism:   Strongyloides stercoralis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Panagrolaimoidea ⇒ Strongyloididae ⇒ Strongyloides.

Sequence Information back to top


Sequence length:   231

Substrate Binding Site:   NLFQ           CVV:   469       CHI:   -0.4

Selectivity Filter:   LIRI           CVV:   520       CHI:   8.3

Fasta sequence:

>tr|A0A0K0ESE3|A0A0K0ESE3_STRER|Unreviewed|Strongyloides_stercoralis|231
MNFTEIFGIYVGLLGLSLCFLPLISVKEWIKKKCSDGFPSVGYVTSTYINAVWLKYGLMS
QIDNQNTFLIIMLILNGIYSFIYLFYSSNKKKFIMENILMLIFTYIVLLYTDSLIYEEGT
IFIGRIASFSNSLRFVPAIADIYNVITNKTTEYVPFQQTCAFAFILSQFLIHSLMTGNYY
RMYAQIAGLSTVAIYFILYYIYPPQTWEVPIFKKNSTKSDNKIKNKDKKIN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: A0A0K0ESE3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K0ESE3_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.1% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K0ESE3_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.0% allowed    .5% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K0ESE3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.4% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur