Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K0EPZ4

dbSWEET id: dbswt_1040

Accession:   A0A0K0EPZ4

Uniprot status:   Unreviewed

Organism:   Strongyloides stercoralis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Panagrolaimoidea ⇒ Strongyloididae ⇒ Strongyloides.

Sequence Information back to top


Sequence length:   227

Substrate Binding Site:   MNWN           CVV:   431       CHI:   -2.9

Selectivity Filter:   FMGL           CVV:   431       CHI:   8.1

Fasta sequence:

>tr|A0A0K0EPZ4|A0A0K0EPZ4_STRER|Unreviewed|Strongyloides_stercoralis|227
MNAIELFGLWLAVFSIGFTFLPIFQVLEWKKRGSSDGFSSINLVLPMLMMSCWFKHGILT
DDKNNMMINGINLFFFTFYVSIFAYYQSRRRNVLMQVMSLLTTIYFIFKHVDNTHPDKAP
DVMGSIAAGTQIFGMIGGIYDLLRAIKLGTMEYIPAVIQFAIFPLTAQWTLFGYLVGNQY
MFIANIAGLLLNIVTLAAYFVYPPLTWKVPIFNIEPQRKIKSDKKKQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: A0A0K0EPZ4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K0EPZ4_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.9% favored    8.9% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K0EPZ4_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.4% favored    8.3% allowed    .0% week    2.2% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K0EPZ4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    7.2% allowed    .6% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur