Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0K0EH94

dbSWEET id: dbswt_1039

Accession:   A0A0K0EH94

Uniprot status:   Unreviewed

Organism:   Strongyloides stercoralis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Panagrolaimoidea ⇒ Strongyloididae ⇒ Strongyloides.

Sequence Information back to top


Sequence length:   233

Substrate Binding Site:   SQAN           CVV:   350       CHI:   -6

Selectivity Filter:   LGSM           CVV:   369       CHI:   4.5

Fasta sequence:

>tr|A0A0K0EH94|A0A0K0EH94_STRER|Unreviewed|Strongyloides_stercoralis|233
MESYESISYSLSQLIGLFTENILWSLFLTSTAIHAILLISSPIQAVFKWFRRQSSDSDTC
IPYIAGVIGSSLWLRYAIFISDYKMILLQSYAVLMQSFFIISLLIFRSKKKKLIRSVFIV
YSIILFYNYYASIIPFEDGKILTGRLASTAQIAGSLVCPYLIYQAITTKVIDFVPMAPVA
FTWVMEAHAIIYSIGIDDFYMLLANTIFFCMDGSLLCMFFIFPTDKSPTQKPL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   17     Model end:   224

Alignment file: A0A0K0EH94.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0K0EH94_inward.pdb

Procheck score ⇒ Ramachandran plot: 85.4% favored    12.5% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0K0EH94_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.5% favored    9.9% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0K0EH94_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.1% favored    9.9% allowed    1.0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur