| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0K0CTV3
dbSWEET id: dbswt_1036
Accession: A0A0K0CTV3
Uniprot status: Unreviewed
Organism: Angiostrongylus cantonensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Metastrongyloidea ⇒ Angiostrongylidae ⇒ Angiostrongylus.
Sequence Information back to top
Sequence length: 220
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LSSV CVV: 375 CHI: 6.4
Fasta sequence:
>tr|A0A0K0CTV3|A0A0K0CTV3_ANGCA|Unreviewed|Angiostrongylus_cantonensis|220
MTFGGDLLPYLSFSAICSTIGLFLCGVQICWRIQERGGTEGTGSAPFLIAFISCAFWLQY
GVLKQDRVVIFVNVVGLVLQGCYLTYYYWMTRHSKILKKVIICELFAIGLMLYSVNYAGL
KDSGRDTLGVICIILNIASIGAPLFQIGEVIRTKNSETLPLPLCLACFAVSLQWLLYGIL
VNDFVIQVPNYIATFLSIIQLSLFIIYPRRPIFVQMKDSI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: A0A0K0CTV3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0K0CTV3_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.7% favored 6.0% allowed 1.6% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0K0CTV3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 4.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0K0CTV3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.6% favored 8.2% allowed 1.1% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA