| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0J8H0S8
dbSWEET id: dbswt_1404
Accession: A0A0J8H0S8
Uniprot status: Unreviewed
Organism: Gammaproteobacteria bacterium
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 105
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A0J8H0S8|A0A0J8H0S8_9GAMM|Unreviewed|Gammaproteobacteria bacterium| 105
MTTIEIIGFTSAFLTTFSFLPQAIQVIKTRDTASLSLAMYSIFTIGVAGWLAYGLIKQDM
AMIVANMVTFVLAGIILAIKLYNAFITDRKSTMINADNTTRDLSA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0J8H0S8_inward.pdb Alignment file: A0A0J8H0S8_inw.pir Procheck score ⇒ Ramachandran plot: 94.2% favored 4.3% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0J8H0S8_outward.pdb Alignment file: A0A0J8H0S8_out.pir Procheck score ⇒ Ramachandran plot: 92.0% favored 6.5% allowed .7% week .7% disallowed Occluded: Model structure: A0A0J8H0S8_occluded.pdb Alignment file: A0A0J8H0S8_occ.pir Procheck score ⇒ Ramachandran plot: 96.4% favored 3.6% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA