Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0J8H0S8

dbSWEET id: dbswt_1404

Accession:   A0A0J8H0S8

Uniprot status:   Unreviewed

Organism:   Gammaproteobacteria bacterium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria.

Sequence Information back to top


Sequence length:   105

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0J8H0S8|A0A0J8H0S8_9GAMM|Unreviewed|Gammaproteobacteria bacterium| 105
MTTIEIIGFTSAFLTTFSFLPQAIQVIKTRDTASLSLAMYSIFTIGVAGWLAYGLIKQDM
AMIVANMVTFVLAGIILAIKLYNAFITDRKSTMINADNTTRDLSA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0J8H0S8_inward.pdb    Alignment file: A0A0J8H0S8_inw.pir

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.3% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0J8H0S8_outward.pdb    Alignment file: A0A0J8H0S8_out.pir

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.5% allowed    .7% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0J8H0S8_occluded.pdb    Alignment file: A0A0J8H0S8_occ.pir

Procheck score ⇒ Ramachandran plot: 96.4% favored    3.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur