Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0J8CG15

dbSWEET id: dbswt_392

Accession:   A0A0J8CG15

Uniprot status:   Unreviewed

Organism:   Beta vulgaris

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ Caryophyllales ⇒ Chenopodiaceae ⇒ Betoideae ⇒ Beta.

Sequence Information back to top


Sequence length:   324

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVT           CVV:   376       CHI:   6.9

Fasta sequence:

>tr|A0A0J8CG15|A0A0J8CG15_BETVU|Unreviewed|Beta_vulgaris|324
MFTIHHPWVFAFGLLGNVISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIY
YALLKGNSVLLITINVAGVIIETIYVAIYITYAPRQARISTLKLLLFMNFCGFCTIVLFC
HYLVKAENRLQVFGWICVAFSISVFAAPLSVMRTVISTKSVEYMPINLSISLTLTATIWF
LYGFVQKDLYITLPNVVGFMFGVAQMGLYSIYRKYDIKAKKEKLPEVASPVKQETVEIDT
INSSPNKTESEDYIPPHEKTPEIEVVVTGNKDDDIDDEQLGNKDHQEYLYGPPQGPSKCN
VDVDKVVGGPAPGPTSVQLVQCAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: A0A0J8CG15.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0J8CG15_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    1.0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0J8CG15_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.8% favored    2.1% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0J8CG15_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    5.2% allowed    .0% week    .5% disallowed

Gene Informationback to top


Gene ID:   104893854     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur