Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0J8BC97

dbSWEET id: dbswt_919

Accession:   A0A0J8BC97

Uniprot status:   Unreviewed

Organism:   Beta vulgaris

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ Caryophyllales ⇒ Chenopodiaceae ⇒ Betoideae ⇒ Beta.

Sequence Information back to top


Sequence length:   273

Substrate Binding Site:   CSWN           CVV:   418       CHI:   -2.7

Selectivity Filter:   LNMS           CVV:   417       CHI:   1.4

Fasta sequence:

>tr|A0A0J8BC97|A0A0J8BC97_BETVU|Unreviewed|Beta_vulgaris|273
MVSPAVARFAVGILGNIISFSLYLSPMPTFMRICKKGSVEQYSATPYLLTFFNCMLWTIY
GMPFIQPNNILLSTISASGCLIEFIYLMLFIIYTGNKKNRIFLILLVLGEILVVAIALTL
VLIFTHTSKQRTLIFGLLGDVSGVLMYAAPLAIMKQVIKTKSVEFMPLAVSVTCFGSAVI
WTLYAIRPFDPFVVAPNGIGCFLGLAQLMLYAAYYKSTKQQMDARKVAEIEKVEMGLKEV
IVVTRESNKVNSLPENDYSAPPKPKENDFASNL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   216

Alignment file: A0A0J8BC97.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0J8BC97_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.9% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0J8BC97_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.8% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0J8BC97_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    4.8% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Gene ID:   104908211     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur