Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0J7IRZ6

dbSWEET id: dbswt_1402

Accession:   A0A0J7IRZ6

Uniprot status:   Unreviewed

Organism:   Chryseobacterium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Chryseobacterium.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0J7IRZ6|A0A0J7IRZ6_9FLAO|Unreviewed|Chryseobacterium|86
MNNTFFTILGWVATVTAMAMYVSYIPQISNNLKGLKGDWLQPLVAAINCTLWVTYGLLKK
PKRDWPVAIANSPGIIFGLIAFITAI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0J7IRZ6_inward.pdb    Alignment file: A0A0J7IRZ6_inw.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.4% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0J7IRZ6_outward.pdb    Alignment file: A0A0J7IRZ6_out.pir

Procheck score ⇒ Ramachandran plot: 96.2% favored    3.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0J7IRZ6_occluded.pdb    Alignment file: A0A0J7IRZ6_occ.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    3.8% allowed    .8% week    3.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur