| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0J5SAZ3
dbSWEET id: dbswt_1399
Accession: A0A0J5SAZ3
Uniprot status: Unreviewed
Organism: Fructobacillus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Fructobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0J5SAZ3|A0A0J5SAZ3_9LACT|Unreviewed|Fructobacillus| 104
MRIDTSEYPTGENAIPEKRVKRLKLLSKAATFTCIAMYVSYIPQIISNFSGHPVGVLQPL
VAMINASFWAGYGWTKTYKDWPIIISNVPGILFGLFTVITIYIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: A0A0J5SAZ3_inward.pdb Alignment file: A0A0J5SAZ3_inw.pir Procheck score ⇒ Ramachandran plot: 82.5% favored 12.7% allowed 3.2% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0J5SAZ3_outward.pdb Alignment file: A0A0J5SAZ3_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 8.7% allowed 1.6% week .0% disallowed Occluded: Model structure: A0A0J5SAZ3_occluded.pdb Alignment file: A0A0J5SAZ3_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA