Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0H5SAC0

dbSWEET id: dbswt_1035

Accession:   A0A0H5SAC0

Uniprot status:   Unreviewed

Organism:   Brugia malayi

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Spirurida ⇒ Filarioidea ⇒ Onchocercidae ⇒ Brugia.

Sequence Information back to top


Sequence length:   223

Substrate Binding Site:   MNWN           CVV:   355       CHI:   -7.9

Selectivity Filter:   FMSL           CVV:   456       CHI:   7.7

Fasta sequence:

>tr|A0A0H5SAC0|A0A0H5SAC0_BRUMA|Unreviewed|Brugia_malayi|223
MVALLSIFAVWLTFFSICFTFLPMLQVLNWRKRGTADGFSSINLVLPVLMMGCWLRHGYM
TNDFTNIFINTINLIVFVGYIIAFAFYQPCRRYLCLQLFALFFTLFCIFSYVNWQPNDVA
ADVMGSIAAAMQIISLGGQIYEIKRAISFGHTEFIPAEMQFGIFLLAIQWTIFGILIDNY
YIAVANFAGFLVNIATISLYFIYPPLTWKVPIIGTGPQQKKTE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   205

Alignment file: A0A0H5SAC0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0H5SAC0_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.0% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0H5SAC0_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.5% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0H5SAC0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.6% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur