Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0H2Q7R4
dbSWEET id: dbswt_1398
Accession: A0A0H2Q7R4
Uniprot status: Unreviewed
Organism: Moellerella wisconsensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Moellerella.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0H2Q7R4|A0A0H2Q7R4_9GAMM|Unreviewed|Moellerella wisconsensis|92
MLEDQVSSTNAPKYVSYIGWIATFTAFCMYVSYIPQIMDNLDGNKTNPLQPAAAAINCIL
WVWYGLKVKDLPVAVANAPGVIFGIIACLTAF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 19 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: A0A0H2Q7R4_inward.pdb Alignment file: A0A0H2Q7R4_inw.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.0% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0H2Q7R4_outward.pdb Alignment file: A0A0H2Q7R4_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.8% allowed .8% week .0% disallowed Occluded: Model structure: A0A0H2Q7R4_occluded.pdb Alignment file: A0A0H2Q7R4_occ.pir Procheck score ⇒ Ramachandran plot: 96.0% favored 3.2% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA