Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0H1RQY8
dbSWEET id: dbswt_1396
Accession: A0A0H1RQY8
Uniprot status: Unreviewed
Organism: Lactococcus lactis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Lactococcus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CACA CVV: 306 CHI: 8.6
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0H1RQY8|A0A0H1RQY8_LACLL|Unreviewed|Lactococcus lactis|86
MNQEKFIKYLSWVATGMSVMMYVSYLPQIANNLSGMKGNPIQPLVAAINCTLWVTYGIGK
KPRDLALATANFPGIIFGLVTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A0H1RQY8_inward.pdb Alignment file: A0A0H1RQY8_inw.pir Procheck score ⇒ Ramachandran plot: 90.2% favored 9.0% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0H1RQY8_outward.pdb Alignment file: A0A0H1RQY8_out.pir Procheck score ⇒ Ramachandran plot: 86.1% favored 9.8% allowed 3.3% week .8% disallowed Occluded: Model structure: A0A0H1RQY8_occluded.pdb Alignment file: A0A0H1RQY8_occ.pir Procheck score ⇒ Ramachandran plot: 84.4% favored 13.1% allowed 2.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA