| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0G9FIT7
dbSWEET id: dbswt_1395
Accession: A0A0G9FIT7
Uniprot status: Unreviewed
Organism: Lactobacillus plantarum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: GNGN CVV: 288 CHI: -7.8
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0G9FIT7|A0A0G9FIT7_LACPN|Unreviewed|Lactobacillus plantarum|90
MDPKRVKYLKLISKLATFTCIAMYVSYIPQIISNFSGDPVSPLQPLVAMINGILWTGYGW
FKTYKDWPVIISNVPGVVFGFITVLTVYIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 13 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: A0A0G9FIT7_inward.pdb Alignment file: A0A0G9FIT7_inw.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 5.6% allowed .8% week 2.4% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0G9FIT7_outward.pdb Alignment file: A0A0G9FIT7_out.pir Procheck score ⇒ Ramachandran plot: 87.1% favored 10.5% allowed 2.4% week .0% disallowed Occluded: Model structure: A0A0G9FIT7_occluded.pdb Alignment file: A0A0G9FIT7_occ.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 6.5% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA