| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0G1YP72
dbSWEET id: dbswt_1393
Accession: A0A0G1YP72
Uniprot status: Unreviewed
Organism: Candidatus Kaiserbacteria
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: LNLN CVV: 440 CHI: 0.6
Fasta sequence:
>tr|A0A0G1YP72|A0A0G1YP72_9BACT|Unreviewed|Candidatus Kaiserbacteria|90
MLTAIFGTLATATGTCLMLPQLYKTFKTKSVKDVSWGMLVVYFLNSIFWLIYGLLINATP
IVFTNIIALVVSIAQIILQVRYSKESNAMI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A0G1YP72_inward.pdb Alignment file: A0A0G1YP72_inw.pir Procheck score ⇒ Ramachandran plot: 92.8% favored 7.2% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0G1YP72_outward.pdb Alignment file: A0A0G1YP72_out.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 5.1% allowed .0% week .0% disallowed Occluded: Model structure: A0A0G1YP72_occluded.pdb Alignment file: A0A0G1YP72_occ.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 2.2% allowed .7% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA