Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0G1X8F8

dbSWEET id: dbswt_1391

Accession:   A0A0G1X8F8

Uniprot status:   Unreviewed

Organism:   Microgenomates group

Kingdom:   Bacteria

Taxonomy back to top


Bacteria.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   TQTQ           CVV:   414       CHI:   -8.4

Fasta sequence:

>tr|A0A0G1X8F8|A0A0G1X8F8_9BACT|Unreviewed|Microgenomates group|92
MINDQKRKISLAKVTVGLSLVTTTIGLGEQALRIWKLRSAVEISIFFFALLATQCFFWVL
YGLQKKDRNIIVANVFGALLALVIVFEWLWFR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   90

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0G1X8F8_inward.pdb    Alignment file: A0A0G1X8F8_inw.pir

Procheck score ⇒ Ramachandran plot: 89.6% favored    10.4% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0G1X8F8_outward.pdb    Alignment file: A0A0G1X8F8_out.pir

Procheck score ⇒ Ramachandran plot: 86.8% favored    11.1% allowed    2.1% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0G1X8F8_occluded.pdb    Alignment file: A0A0G1X8F8_occ.pir

Procheck score ⇒ Ramachandran plot: 91.7% favored    6.2% allowed    2.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur