Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0G1N419

dbSWEET id: dbswt_1389

Accession:   A0A0G1N419

Uniprot status:   Unreviewed

Organism:   Parcubacteria group

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ unclassified Parcubacteria group.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   WNWN           CVV:   518       CHI:   -8.8

Selectivity Filter:   GTGT           CVV:   282       CHI:   -2.2

Fasta sequence:

>tr|A0A0G1N419|A0A0G1N419_9BACT|Unreviewed|Parcubacteria group|92
MAGYTKAMFEIVRWSTLSSTILLAVVGYSDQIRLIFVNQSTAGLSFWMILLATWTWASYT
LYGHFQKDRKIFWPNLLGTILIGIVLLGFFIF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0G1N419_inward.pdb    Alignment file: A0A0G1N419_inw.pir

Procheck score ⇒ Ramachandran plot: 95.6% favored    3.7% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0G1N419_outward.pdb    Alignment file: A0A0G1N419_out.pir

Procheck score ⇒ Ramachandran plot: 97.1% favored    1.5% allowed    1.5% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0G1N419_occluded.pdb    Alignment file: A0A0G1N419_occ.pir

Procheck score ⇒ Ramachandran plot: 95.6% favored    2.9% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur