Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0G1N419
dbSWEET id: dbswt_1389
Accession: A0A0G1N419
Uniprot status: Unreviewed
Organism: Parcubacteria group
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: WNWN CVV: 518 CHI: -8.8
Selectivity Filter: GTGT CVV: 282 CHI: -2.2
Fasta sequence:
>tr|A0A0G1N419|A0A0G1N419_9BACT|Unreviewed|Parcubacteria group|92
MAGYTKAMFEIVRWSTLSSTILLAVVGYSDQIRLIFVNQSTAGLSFWMILLATWTWASYT
LYGHFQKDRKIFWPNLLGTILIGIVLLGFFIF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 14 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: A0A0G1N419_inward.pdb Alignment file: A0A0G1N419_inw.pir Procheck score ⇒ Ramachandran plot: 95.6% favored 3.7% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0G1N419_outward.pdb Alignment file: A0A0G1N419_out.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 1.5% allowed 1.5% week .0% disallowed Occluded: Model structure: A0A0G1N419_occluded.pdb Alignment file: A0A0G1N419_occ.pir Procheck score ⇒ Ramachandran plot: 95.6% favored 2.9% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA