Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0G1L8V3

dbSWEET id: dbswt_1983

Accession:   A0A0G1L8V3

Uniprot status:   Unreviewed

Organism:   Candidatus Jorgensenbacteria

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Candidatus Jorgensenbacteria.

Sequence Information back to top


Sequence length:   113

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   MYMY           CVV:   530       CHI:   1.2

Fasta sequence:

>tr|A0A0G1L8V3|A0A0G1L8V3_9BACT|Unreviewed|Candidatus Jorgensenbacteria| 113
MQTTNPQHHIHLRKQASKKLEAYPHPVTWKRWLDRTVYVAGVLGPLMTLPQVLNVWESKS
TSGVSPETWISYSVYSAVWVVYGFAHKEKPIILSNGLFFIFNTLVAIGTLLSR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   35     Model end:   111

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0G1L8V3_inward.pdb    Alignment file: A0A0G1L8V3_inw.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.5% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0G1L8V3_outward.pdb    Alignment file: A0A0G1L8V3_out.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    3.9% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0G1L8V3_occluded.pdb    Alignment file: A0A0G1L8V3_occ.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    3.9% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur