Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0G1K7A2

dbSWEET id: dbswt_1388

Accession:   A0A0G1K7A2

Uniprot status:   Unreviewed

Organism:   Candidatus Wolfebacteria

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Candidatus Wolfebacteria.

Sequence Information back to top


Sequence length:   97

Substrate Binding Site:   YNYN           CVV:   474       CHI:   -9.6

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A0A0G1K7A2|A0A0G1K7A2_9BACT|Unreviewed|Candidatus Wolfebacteria|97
MIDLTQLLAVLAGFMGILMGFANIPQAVKIYKKRSAKDVSELTYGVLAVGYFVLLLYSIL
LDNVALIVTNLFGLLGVVLVLSGIIRYEKKGIRHRGI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0G1K7A2_inward.pdb    Alignment file: A0A0G1K7A2_inw.pir

Procheck score ⇒ Ramachandran plot: 90.9% favored    9.1% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0G1K7A2_outward.pdb    Alignment file: A0A0G1K7A2_out.pir

Procheck score ⇒ Ramachandran plot: 90.2% favored    9.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0G1K7A2_occluded.pdb    Alignment file: A0A0G1K7A2_occ.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    3.8% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur