Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0G0W6Q4

dbSWEET id: dbswt_1386

Accession:   A0A0G0W6Q4

Uniprot status:   Unreviewed

Organism:   candidate division

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ candidate division CPR2.

Sequence Information back to top


Sequence length:   97

Substrate Binding Site:   GSGS           CVV:   242       CHI:   -2.4

Selectivity Filter:   ILIL           CVV:   496       CHI:   16.6

Fasta sequence:

>tr|A0A0G0W6Q4|A0A0G0W6Q4_9BACT|Unreviewed|candidate division|97
MIDSLISWLLQNISIILIIISTPIELMPFLQMKKSIKNKSVNDLSPYPAAGFSLLGIMWL
SYGMGINSLPLVVTNVAKLISNISVVCVYFYFRSIKK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   97

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0G0W6Q4_inward.pdb    Alignment file: A0A0G0W6Q4_inw.pir

Procheck score ⇒ Ramachandran plot: 77.8% favored    16.5% allowed    2.5% week    3.2% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0G0W6Q4_outward.pdb    Alignment file: A0A0G0W6Q4_out.pir

Procheck score ⇒ Ramachandran plot: 82.9% favored    13.9% allowed    1.9% week    1.3% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0G0W6Q4_occluded.pdb    Alignment file: A0A0G0W6Q4_occ.pir

Procheck score ⇒ Ramachandran plot: 84.8% favored    11.4% allowed    3.8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur