Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0G0W6Q4
dbSWEET id: dbswt_1386
Accession: A0A0G0W6Q4
Uniprot status: Unreviewed
Organism: candidate division
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 97
Substrate Binding Site: GSGS CVV: 242 CHI: -2.4
Selectivity Filter: ILIL CVV: 496 CHI: 16.6
Fasta sequence:
>tr|A0A0G0W6Q4|A0A0G0W6Q4_9BACT|Unreviewed|candidate division|97
MIDSLISWLLQNISIILIIISTPIELMPFLQMKKSIKNKSVNDLSPYPAAGFSLLGIMWL
SYGMGINSLPLVVTNVAKLISNISVVCVYFYFRSIKK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 97 Inward Open: Template: 4X5M.pdb Model structure: A0A0G0W6Q4_inward.pdb Alignment file: A0A0G0W6Q4_inw.pir Procheck score ⇒ Ramachandran plot: 77.8% favored 16.5% allowed 2.5% week 3.2% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0G0W6Q4_outward.pdb Alignment file: A0A0G0W6Q4_out.pir Procheck score ⇒ Ramachandran plot: 82.9% favored 13.9% allowed 1.9% week 1.3% disallowed Occluded: Model structure: A0A0G0W6Q4_occluded.pdb Alignment file: A0A0G0W6Q4_occ.pir Procheck score ⇒ Ramachandran plot: 84.8% favored 11.4% allowed 3.8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA