Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0G0JJL2

dbSWEET id: dbswt_1382

Accession:   A0A0G0JJL2

Uniprot status:   Unreviewed

Organism:   Candidatus Levybacteria

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Candidatus Levybacteria.

Sequence Information back to top


Sequence length:   97

Substrate Binding Site:   YIYI           CVV:   530       CHI:   6.4

Selectivity Filter:   GVGV           CVV:   306       CHI:   7.6

Fasta sequence:

>tr|A0A0G0JJL2|A0A0G0JJL2_9BACT|Unreviewed|Candidatus Levybacteria|97
MNIVEVGLIIGILTTVLSILVKVVGFPDQIRKNYKRKSTEGVSTSFYILSFLVYMLWTAH
GVLQKDWVVILGQGLGIITTGVIVYQILIYRKKIIIC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   94

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0G0JJL2_inward.pdb    Alignment file: A0A0G0JJL2_inw.pir

Procheck score ⇒ Ramachandran plot: 90.3% favored    7.6% allowed    2.1% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0G0JJL2_outward.pdb    Alignment file: A0A0G0JJL2_out.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    9.7% allowed    1.4% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0G0JJL2_occluded.pdb    Alignment file: A0A0G0JJL2_occ.pir

Procheck score ⇒ Ramachandran plot: 91.0% favored    6.2% allowed    2.8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur