Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0G0GLN4

dbSWEET id: dbswt_1381

Accession:   A0A0G0GLN4

Uniprot status:   Unreviewed

Organism:   Candidatus Levybacteria

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Candidatus Levybacteria.

Sequence Information back to top


Sequence length:   104

Substrate Binding Site:   CACA           CVV:   306       CHI:   8.6

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0G0GLN4|A0A0G0GLN4_9BACT|Unreviewed|Candidatus Levybacteria| 104
MAARAYQKRQNQLLRQLLGMKIDQKFIERIGWAASIIAILMWFSFIDQIRLNLAGHKGSL
LIPIVVTINCVLWTLFGLGKKNWQIVTANVPGIFTGAITVLTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   31     Model end:   104

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0G0GLN4_inward.pdb    Alignment file: A0A0G0GLN4_inw.pir

Procheck score ⇒ Ramachandran plot: 88.1% favored    7.9% allowed    3.2% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0G0GLN4_outward.pdb    Alignment file: A0A0G0GLN4_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.1% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0G0GLN4_occluded.pdb    Alignment file: A0A0G0GLN4_occ.pir

Procheck score ⇒ Ramachandran plot: 86.5% favored    13.5% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur