| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0F8CCH6
dbSWEET id: dbswt_2050
Accession: A0A0F8CCH6
Uniprot status: Unreviewed
Organism: Methanosarcina
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Euryarchaeota ⇒ Methanomicrobia ⇒ Methanosarcinales;Methanosarcinaceae ⇒ Methanosarcina.
Sequence Information back to top
Sequence length: 103
Substrate Binding Site: MNMN CVV: 440 CHI: -3.2
Selectivity Filter: ACAC CVV: 306 CHI: 8.6
Fasta sequence:
>tr|A0A0F8CCH6|A0A0F8CCH6_9EURY|Unreviewed|Methanosarcina|103
MIGYIAGALTTIAFAPSLIKALTTKSTTDISLLMLLCSTSCMVLWLFYGIQVDAPAIIAA
NSVSVILAASLRGLKLNYEYINLVDNFGKKIRGSKNKNAFLWK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 77 Inward Open: Template: 4X5M.pdb Model structure: A0A0F8CCH6_inward.pdb Alignment file: A0A0F8CCH6_inw.pir Procheck score ⇒ Ramachandran plot: 94.1% favored 4.4% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0F8CCH6_outward.pdb Alignment file: A0A0F8CCH6_out.pir Procheck score ⇒ Ramachandran plot: 94.1% favored 5.9% allowed .0% week .0% disallowed Occluded: Model structure: A0A0F8CCH6_occluded.pdb Alignment file: A0A0F8CCH6_occ.pir Procheck score ⇒ Ramachandran plot: 95.6% favored 4.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA