Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0F7K9K0

dbSWEET id: dbswt_1379

Accession:   A0A0F7K9K0

Uniprot status:   Unreviewed

Organism:   Nitrosomonas communis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Nitrosomonadales ⇒ Nitrosomonadaceae ⇒ Nitrosomonas.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   QVQV           CVV:   438       CHI:   1.4

Selectivity Filter:   AFAF           CVV:   404       CHI:   9.2

Fasta sequence:

>tr|A0A0F7K9K0|A0A0F7K9K0_9PROT|Unreviewed|Nitrosomonas communis|89
MEGHEIVGFVAGFGTTFAAAPDLLAILKRRSSQGMNPTMAGIMGSFQIMWVYYGILIDSM
PVVVWNIIAVVINFLMVGVFFYFARIGKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0F7K9K0_inward.pdb    Alignment file: A0A0F7K9K0_inw.pir

Procheck score ⇒ Ramachandran plot: 89.0% favored    9.6% allowed    .7% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0F7K9K0_outward.pdb    Alignment file: A0A0F7K9K0_out.pir

Procheck score ⇒ Ramachandran plot: 88.2% favored    11.0% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0F7K9K0_occluded.pdb    Alignment file: A0A0F7K9K0_occ.pir

Procheck score ⇒ Ramachandran plot: 89.0% favored    9.6% allowed    .7% week    .7% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur