| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0F7K9K0
dbSWEET id: dbswt_1379
Accession: A0A0F7K9K0
Uniprot status: Unreviewed
Organism: Nitrosomonas communis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Nitrosomonadales ⇒ Nitrosomonadaceae ⇒ Nitrosomonas.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: QVQV CVV: 438 CHI: 1.4
Selectivity Filter: AFAF CVV: 404 CHI: 9.2
Fasta sequence:
>tr|A0A0F7K9K0|A0A0F7K9K0_9PROT|Unreviewed|Nitrosomonas communis|89
MEGHEIVGFVAGFGTTFAAAPDLLAILKRRSSQGMNPTMAGIMGSFQIMWVYYGILIDSM
PVVVWNIIAVVINFLMVGVFFYFARIGKN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A0F7K9K0_inward.pdb Alignment file: A0A0F7K9K0_inw.pir Procheck score ⇒ Ramachandran plot: 89.0% favored 9.6% allowed .7% week .7% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0F7K9K0_outward.pdb Alignment file: A0A0F7K9K0_out.pir Procheck score ⇒ Ramachandran plot: 88.2% favored 11.0% allowed .0% week .7% disallowed Occluded: Model structure: A0A0F7K9K0_occluded.pdb Alignment file: A0A0F7K9K0_occ.pir Procheck score ⇒ Ramachandran plot: 89.0% favored 9.6% allowed .7% week .7% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA