Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0F6T9B8
dbSWEET id: dbswt_1033
Accession: A0A0F6T9B8
Uniprot status: Unreviewed
Organism: Capra hircus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Cetartiodactyla ⇒ Ruminantia ⇒ Pecora ⇒ Bovidae ⇒ Caprinae ⇒ Capra.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|A0A0F6T9B8|A0A0F6T9B8_CAPHI|Unreviewed|Capra_hircus|226
MEAGGLADSLLSGACVLFTLGMFSTGLSDLKHMRMTRSVDSVQFLPFLTTDVNNLSWLSY
GALKGNWTLIVVNAVGAVLQTLYILVYLHYCHRKRAVLLQTTTLLGVLVLGFAYFWLLVP
DPEMRLQHLGLFCSVFTISMYLSPLADLAKVIRTKSTQRLSFSLTIATLLTSASWTLYGF
RLKDPYIVVPNLPGILTSFIRFWLFWKYSPGVRQELSASTNLREFT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A0F6T9B8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0F6T9B8_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 3.7% allowed 3.2% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0F6T9B8_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 6.4% allowed 1.6% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0F6T9B8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 3.2% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 102191663 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA