Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0F5ZS71
dbSWEET id: dbswt_1378
Accession: A0A0F5ZS71
Uniprot status: Unreviewed
Organism: Grimontia
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Vibrionales ⇒ Vibrionaceae ⇒ Grimontia.
Sequence Information back to top
Sequence length: 97
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: AIAI CVV: 382 CHI: 12.6
Fasta sequence:
>tr|A0A0F5ZS71|A0A0F5ZS71_9GAMM|Unreviewed|Grimontia|97
MSVIEKIGKALEPLMLVMGLVSPLATLPQIYKLYFSHSEHAAGLSLTTWVLYSFIAMLWT
IYGLYHKNPTIWVGNGLGFLMYLAMVAGIIARVGITF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: A0A0F5ZS71_inward.pdb Alignment file: A0A0F5ZS71_inw.pir Procheck score ⇒ Ramachandran plot: 92.4% favored 6.8% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0F5ZS71_outward.pdb Alignment file: A0A0F5ZS71_out.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 4.5% allowed .8% week .8% disallowed Occluded: Model structure: A0A0F5ZS71_occluded.pdb Alignment file: A0A0F5ZS71_occ.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 3.8% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA